Protein information for: OR4K4P



AFSRGYGAILYEDFWHFSNLHFTAIITLSTNILILTCVPFQFTYSHIVKC
XLQGNLPQTQTINSETIWIKIIHDFLHEPKTISFEGCMAQIFLFHVFAGG
EMVLLVAMAYDIYVAICKPLHYATIMNLCTCTGLVVGSWVTGVMHSLSQL
AFTVSLPFCGPNIVDSYYCDLTLVIKLACTDTYIPEALMLLDSGLMGVTS
FSLLLISYTVILITVQRPSSAGMAKARSTLTAHVTVVTLFFGPCIFIYAW
PFSNLPVDNLLSVFSTVFTPILNPLIYTLRNKEVKSAIHNLKTQYVTSRL
SSQLSLIGP
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 13 39 DFWHFSNLHFTAIITLSTNILILTCVP
TM2 51 73 XLQGNLPQTQTINSETIWIKIIH
TM3 88 108 MAQIFLFHVFAGGEMVLLVAM
TM4 131 151 CTGLVVGSWVTGVMHSLSQLA
TM5 188 209 LMLLDSGLMGVTSFSLLLISYT
TM6 230 254 LTAHVTVVTLFFGPCIFIYAWPFSN
TM7 259 276 LLSVFSTVFTPILNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage