Protein information for: OR4K6P



MEGFNCSRVSEFMLLGLTDSPELQRFFFVVFSVFYLMTMLGNCLILLTVL
STSHLHSPMYFLLSNLSLIDMCLSSFATPKMIMDFFALRKTISFEGCISQ
IFILHLFTGTEIVLLISMSFDRYIAICKPLHYSTIMSQRVCVELVAVSWT
VGFLHTMSQLAFTLYLPFCGPNVVDFFCDLPLVIQLACMDIYVLGIFMIS
TSGVIALISFLLLLTSYIIVLITVRDYSSTGSSKALSTCTAHFIVVLMFF
GPCIFIYVWPSTNFLVDKILSVFYTIFTPFLNPLIYTLRNQEVKTAMKKK
LNIQYFSLGKTAP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QRFFFVVFSVFYLMTMLGNCLILLTVL
TM2 61 83 FLLSNLSLIDMCLSSFATPKMIM
TM3 98 118 ISQIFILHLFTGTEIVLLISM
TM4 141 161 CVELVAVSWTVGFLHTMSQLA
TM5 197 218 FMISTSGVIALISFLLLLTSYI
TM6 239 263 CTAHFIVVLMFFGPCIFIYVWPSTN
TM7 268 285 ILSVFYTIFTPFLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage