Protein information for: OR4Q1P



FNSSFSRSLDILGLXEKKQDSNVTELVLLGLSSSWELQLFLLLLFLFFYI
AIVLGNLLIVVTVQAHAHLLQSPMYYFLGHLSFIDLCLSCVTLPKMLGDF
LQQGKSISFSGCLAQIYFLHFLGASEMFLLTVMAYDRYVAICNPLRYLII
MNPQLCLWLVLACWCGGFIHSIMQVILVIQLPFCGPNELDNFYCDVPQVI
KLACMDTYVVEVLMIANSGLLSLVCFLVLLFSYAVILITLRTHFGQGQNK
FLSTCASHLTVVSLIFMPCIFIYLRPFCSFSVDKIFSMFYTVMTPMLSPL
IYTLRNADMKTAMKKLRIKPCDIPFPC
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 38 64 QLFLLLLFLFFYIAIVLGNLLIVVTVQ
TM2 76 98 YFLGHLSFIDLCLSCVTLPKMLG
TM3 113 133 LAQIYFLHFLGASEMFLLTVM
TM4 156 176 CLWLVLACWCGGFIHSIMQVI
TM5 213 234 LMIANSGLLSLVCFLVLLFSYA
TM6 255 279 CASHLTVVSLIFMPCIFIYLRPFCS
TM7 284 301 IFSMFYTVMTPMLSPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage