Protein information for: OR4Q2P



MDKNQTEVMREFFLSGFSQTPSIEAGLFVLFLFFYMSIWVGNVLIMVTVA
SDKYLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFFNHEKLISYDQCIV
QLFFLHFVGAAEMFLLTVMAYDRYVAICRPLHYTTVMSRGLCCVLVAASW
MGGFVHSTVQTILTVHLPFCGPNQVENFFCDVPPVIKLACADTFVIELLM
VSNSGLISTISFVVLISSYTTILVKIRSKEGRRKALSTCASHLMVVTLFF
GPCIFIYARPFSTFSVDKMVSVLYNVITPMLNPLIYTLRNKEVKSAMQKL
WVRNGLTWKK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 EAGLFVLFLFFYMSIWVGNVLIMVTVA
TM2 62 84 FLLGNLSFLDLCYSTVTTPKLLA
TM3 99 119 IVQLFFLHFVGAAEMFLLTVM
TM4 142 162 CCVLVAASWMGGFVHSTVQTI
TM5 199 220 LMVSNSGLISTISFVVLISSYT
TM6 239 263 CASHLMVVTLFFGPCIFIYARPFST
TM7 268 285 MVSVLYNVITPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage