Protein information for: OR4R2P



DEEDRXXIDNHFMRNIXTSKXFFXHLLXDIKCXSVLCVIFCKXNHHISLL
SFFEYLMTXXKKYGSICSTMLVSIRIKYLEVFAENLFGAAEIIPLMWMVH
GCYVTVCHYMTIVNQYRCSHLTGMAWTESFIHGTVXILSPVXLPFYDPNV
IAHFMCDLNTFLKLLCMGTNTIGFFVAANGGFNYLLNIIFLMVSXVAILC
TLKTHSLEGKMLKFSTCISHTTMVILFFEFCISVYLCPVIPSPINKAMAV
FHTVINPMLKPLVYTLRNAEVKSALRKVWVKRXPEER
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 11 37 HFMRNIXTSKXFFXHLLXDIKCXSVLC
TM2 45 67 HHISLLSFFEYLMTXXKKYGSIC
TM3 78 98 YLEVFAENLFGAAEIIPLMWM
TM4 118 138 CSHLTGMAWTESFIHGTVXIL
TM5 175 196 FVAANGGFNYLLNIIFLMVSXV
TM6 217 241 CISHTTMVILFFEFCISVYLCPVIP
TM7 246 263 AMAVFHTVINPMLKPLVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage