Protein information for: OR4T1P



MDIXKQLNNISEFVLLGIHQHLGTXNFVSXIFLLAYAAIMAGNLTAIAVT
SNPPLCSTPMYFLLGNLSFLSMFISTVTISKMVADVLRENKTTSSWGCMA
QIFHFLGGSEMTLLIFMAVDQHIAICRPLHCRTITNCRVLMATHGLLLLS
RAVGFVHTISQIVFIITLPFCGPSVVDNLFXDLPLVLKLACTETYDLELL
VIAKSGQLSFICFIVLLIFYTIILVTVQHRSSDALSKALSTLSAHITAVT
LFFEPCVYIYTWPFRSFSVDTFLSVFYSVTPLLNPITYSLRXKHLYINXG
RQHIISRQTFSN
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 XNFVSXIFLLAYAAIMAGNLTAIAVTS
TM2 62 84 FLLGNLSFLSMFISTVTISKMVA
TM3 99 117 MAQIFHFLGGSEMTLLIFM
TM4 143 163 THGLLLLSRAVGFVHTISQIV
TM5 200 221 LVIAKSGQLSFICFIVLLIFYT
TM6 242 266 LSAHITAVTLFFEPCVYIYTWPFRS
TM7 271 287 FLSVFYSVTPLLNPITY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage