Protein information for: OR4U1P



MEKQNQSMVPEFILLGFKNPHELQIFFILFFLFSTYPXLSNLIIIFVVKL
DPQLHSPMYFLLANLSSTDMPLASFATPKKIDNVISEYRTISYEGCMTXR
FFLHFLSGSEMVLLLAMAIDRXFAICKPLHYKSICIGLAPRSWTMDFMHT
MSQIVLTVTLPFCGLSVVDIFVCVXSALLIKACTDTYILELXVIADSGLL
SLLCFMFLLISYSTVLIIIXHHSSRGSSKTLSTLSAHIMVVVLFFGACIF
TCERPFSTVSIDVCFXTIFAPLLNPIIYTFRNNDMKKALRKMKINFVSSR
STCNXNIIITKSI
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 LQIFFILFFLFSTYPXLSNLIIIFVVK
TM2 60 82 FLLANLSSTDMPLASFATPKKID
TM3 97 117 MTXRFFLHFLSGSEMVLLLAM
TM4 135 155 CIGLAPRSWTMDFMHTMSQIV
TM5 192 213 XVIADSGLLSLLCFMFLLISYS
TM6 234 258 LSAHIMVVVLFFGACIFTCERPFST
TM7 262 277 VCFXTIFAPLLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage