Protein information for: OR4V1P



IHFSLDTLFLHSTQHMESQRNIXFILMSLSSDPDTYKYLFVVFLFCNVAI
LVGNFLILISIXCSPLFNQPMHYFFRLYDIYYTSCVTPKIIGDLVVGRIN
ISYDRSLSQHFFGIIEIFILTVMAFDHYVAICKPPRYLIIMNRTKYNTLI
SVAWLLGLSHSLFQFSMKIWLPFCGSNKIDDXYXDIFPLLKVACTDTCIT
GVLVVANSGMSCLGNLVLSFGSYVIILFPLKNHSVEGRCKALSTCGSHIT
MVIFFFEPSIFAYLRPVYTFPEDKISALFYTIIAPMFNHLIYNLRNTEMK
KAMRKVWYQISFSEEKQLICPT
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 36 62 YKYLFVVFLFCNVAILVGNFLILISIX
TM2 73 92 YFFRLYDIYYTSCVTPKIIG
TM3 103 123 YDRSLSQHFFGIIEIFILTVM
TM4 146 166 YNTLISVAWLLGLSHSLFQFS
TM5 203 224 LVVANSGMSCLGNLVLSFGSYV
TM6 245 269 CGSHITMVIFFFEPSIFAYLRPVYT
TM7 274 291 ISALFYTIIAPMFNHLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage