Protein information for: OR51A6P



MHLPNSSEIAITTFFLIGIPGLEHAHIWISVPICLMYLVAILGNCTILFV
IRTEPSLHAPMYYFLSMLAVSDLGLSLSYLPTMLRIFVFNATGISSNARF
AQEFFIHGFTDMESSVLLVMSFDRYLAICHPLRYISEVLCILTSARVAKM
GLLFLIKRETTLNSLIRNNXLMLLVLPFPFTLTRLTYCRKSLLSHSYCLH
QDVRKLACSDNTVNFFYGFFLALCMMSESVFITVSYVLILKTIMGIGSHR
ERLKALNTCVSHICAVLIFYAPVIALASMHCFGYLMNCFGKHRSPLAMIL
IADVFLLVPPLMNPIVYCVKTQQIHEKVLGKLGLQQRCQ
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 HIWISVPICLMYLVAILGNCTILFVIR
TM2 63 85 YFLSMLAVSDLGLSLSYLPTMLR
TM3 100 120 FAQEFFIHGFTDMESSVLLVM
TM4 146 166 RVAKMGLLFLIKRETTLNSLI
TM5 217 237 YGFFLALCMMSESVFITVSYV
TM6 259 283 CVSHICAVLIFYAPVIALASMHCFG
TM7 298 317 MILIADVFLLVPPLMNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage