Protein information for: OR51A9P



MIGIPGLEAVHGWLAIPFSSMYTVALPGNCLILLAVKRNPSLHQPMCYFL
SMLALPKAGLTLSTLPITLAVLWFDHRLMGFNACLVQMFFLHSSVVESSV
LLAISFDHFVAISNPLHYAAVLTNSVIIRIGLASWGSSYLVPLPVPFPVK
SLNFCPDNIPSHSFCFHPDVMRRACADITINICYGVYVVVSTGGLDSLLI
FLSYTFILHTVMGLAAPRERIWALNTCVSHIPAVFVFFIPGITVSMIHHF
GRHLPHIVHALVTYVYLVMPSVLHPIIYSMKSKPIREAILRMLMGRSQG
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 11 37 HGWLAIPFSSMYTVALPGNCLILLAVK
TM2 48 70 YFLSMLALPKAGLTLSTLPITLA
TM3 85 104 LVQMFFLHSSVVESSVLLAI
TM4 127 147 IIRIGLASWGSSYLVPLPVPF
TM5 184 205 YGVYVVVSTGGLDSLLIFLSYT
TM6 227 251 CVSHIPAVFVFFIPGITVSMIHHFG
TM7 259 278 HALVTYVYLVMPSVLHPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage