Protein information for: OR51B5



MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKED
HNLHEPMYFFLAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAY
FIHSLSFLESGILLAMAYDRFIAICNPLRYTSVLTNTRVVKIGLGVLMRG
FVSVVPPIRPLYFFLYCHSHVLSHAFCLHQDVIKLACADTTFNRLYPAVL
VVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCVSHICCVLVFY
VTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNA
ILHLFTTHRIGT
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 HHWISVFFLFMYISILFGNGTLLLLIK
TM2 59 81 FFLAMLAATDLGLALTTMPTVLG
TM3 96 116 FSQAYFIHSLSFLESGILLAM
TM4 139 159 VVKIGLGVLMRGFVSVVPPIR
TM5 196 217 YPAVLVVFIFVLDYLIIFISYV
TM6 239 263 CVSHICCVLVFYVTVIGLSLIHRFG
TM7 271 290 HLIMSYAYFLFPPLMNPITY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage