Protein information for: OR51C4P



MSTLQNITSTSIIFLLPGVPGLEAFHTWISIPFCFLYVTALSGNSLILFA
IVTQPSLHEPMYYFLSMLSTTDLGLSISTLVTILGIFCFNVREISFNARL
SQMFFLQLFTVMESSVLLAMAFDRFVAITNPLRYASVLTDLKIAQIXVAI
ITRGTITLTPMVLLLKRLSYCCSHVLHHSYCFYPDVMKLSCTDTRINSAV
GLTALITTAGADSVFIVLSYILIIKTVLSIASPEERKKAFSTCISHIGAV
AVFYIPLITLSFVHRFGKQAPPYVHTLIANAYLLIPPVMNPIIYSVKTKQ
IRXAVLKVLHCSTAKN
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 HTWISIPFCFLYVTALSGNSLILFAIV
TM2 63 85 YFLSMLSTTDLGLSISTLVTILG
TM3 100 120 LSQMFFLQLFTVMESSVLLAM
TM4 143 163 IAQIXVAIITRGTITLTPMVL
TM5 200 221 VGLTALITTAGADSVFIVLSYI
TM6 243 267 CISHIGAVAVFYIPLITLSFVHRFG
TM7 275 294 HTLIANAYLLIPPVMNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage