Protein information for: OR51E1



MMVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIY
IVRTEHSLHEPMYIFLCMLSGIDILISTSSMPKMLAIFWFNSTTIQFDAC
LLQMFAIHSLSGMESTVLLAMAFDRYVAICHPLRHATVLTLPRVTKIGVA
AVVRGAALMAPLPVFIKQLPFCRSNILSHSYCLHQDVMKLACDDIRVNVV
YGLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAV
FIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKE
IRQRILRLFHVATHASEP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QFWLAFPLCSLYLIAVLGNLTIIYIVR
TM2 64 86 IFLCMLSGIDILISTSSMPKMLA
TM3 101 121 LLQMFAIHSLSGMESTVLLAM
TM4 144 164 VTKIGVAAVVRGAALMAPLPV
TM5 201 222 YGLIVIISAIGLDSLLISFSYL
TM6 243 267 CVSHVCAVFIFYVPFIGLSMVHRFS
TM7 275 294 PVILANIYLLVPPVLNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage