Protein information for: OR51F3P



SSSLIFFLTGVPGLEVAHAWISIPFCCLYITALSGNGVILFVIITESSLH
EPMYYFLSMLSTTDLGLCVSTLVTMLGNILVQCKTISFHACVAQTFFIQL
FTVMESSVLLAMAFDRFIAICNPPRYTTILTDSRIVKVWFAILVRGTVIL
LPLALLLKLSFCQSHVLHHSYCFHPDIIQLSCSDNKINSVLGLTALIVTA
GVDSIFILLSYILIIKTVLSIASPEERHKVFSTCISYIGAVAIFYIPLIS
LCFVHRFGKRAPPYAHTLMANAYLLIPPVMNPIIYSVKTKQIRRAIKKIL
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 18 44 HAWISIPFCCLYITALSGNGVILFVII
TM2 55 77 YFLSMLSTTDLGLCVSTLVTMLG
TM3 92 112 VAQTFFIQLFTVMESSVLLAM
TM4 135 155 IVKVWFAILVRGTVILLPLAL
TM5 191 212 LGLTALIVTAGVDSIFILLSYI
TM6 234 258 CISYIGAVAIFYIPLISLCFVHRFG
TM7 266 285 HTLMANAYLLIPPVMNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage