Protein information for: OR51F4P



FLLTGIPGLEWAHVWISIPICCLYLTALSGNTLILFVILTEPTLHETMYY
FLSMLSTTDIGLRISTLVTVLGIFWLNAREISFNTCLSQMFFIHLFTFME
SSVLLAMAFDHFVAISNPLRYATILTHARIAQIGLAVITRGTVILTPLIL
LLKXLSLCRSHVLCHSYCFHPDVMKLSCSDTKINSALRLSAIISTAGVDS
IFILLSYLLIIRSGLSIASPEERKKAFSTCISHITAVGIFYIPLISLSFV
HRFGKHAPPYVPTPIANVYLLIPSVMISPIIYSVKTKQIQKAVLKFVCSK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 13 39 HVWISIPICCLYLTALSGNTLILFVIL
TM2 50 72 YFLSMLSTTDIGLRISTLVTVLG
TM3 87 107 LSQMFFIHLFTFMESSVLLAM
TM4 130 150 IAQIGLAVITRGTVILTPLIL
TM5 187 208 LRLSAIISTAGVDSIFILLSYL
TM6 230 254 CISHITAVGIFYIPLISLSFVHRFG
TM7 263 282 TPIANVYLLIPSVMISPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage