Protein information for: OR51J1



MKISNNSLGFLPTTFILVGIPGLESEHLWISVPFSLIYIIIFLGNGIILH
VIRTDIALHQPMYLFLAMLALAEVRVSASTLPTVLGIFLFGNTEISLEAC
LFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPLHSYPDTAQGLWHRSYYR
TEKHYAHGSVAHSLMASALLWPQCPLTFLLSAPQSYLSCGNISVNNIYGI
FIVTSTFGLDSLLIVISYGLILHTVLGIATGEGRKKALNTCGSHVCAVLA
YYVPMIGLSIVHRLGHRVSPLLQAMMANAYLFFPPVVNPIVYSIKTKEIH
GAIVRMLLEKRRRV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 HLWISVPFSLIYIIIFLGNGIILHVIR
TM2 64 86 LFLAMLALAEVRVSASTLPTVLG
TM3 101 121 LFPDVLHPFFIHDGASCAAGH
TM4 148 168 YYRTEKHYAHGSVAHSLMASA
TM5 198 219 YGIFIVTSTFGLDSLLIVISYG
TM6 241 265 CGSHVCAVLAYYVPMIGLSIVHRLG
TM7 273 292 QAMMANAYLFFPPVVNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage