Protein information for: OR51K1P



MGAESNESLDLLSVFLTGIPGLEAQHGWLSIPFFTMYIVAIVGNILIMAA
VQEDSALHEPMYLFLSMLAVTEVGVSVSTLPTVTGILWFDAHRVDFDGCL
AQMFFIHTFSCMESGVLLAMSYDRFVAIYNLLRYTAILTLPRIICMGLGI
TLKSVALMAPLPILLRQLPYCHTNVLSHSYCLHSDLIQLPCADTKLNSIL
GLAIVLANFGLDSLLIVVSYVLILYTVMGIASGEGRWKALNTCVSHICAV
LIYYVPMIGVSVMHRAAKHASPIVHTLMSSICLLVPPVLNPIIYSVKTQT
IRQGILTLFSCKRELL
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 HGWLSIPFFTMYIVAIVGNILIMAAVQ
TM2 63 85 LFLSMLAVTEVGVSVSTLPTVTG
TM3 100 120 LAQMFFIHTFSCMESGVLLAM
TM4 143 163 IICMGLGITLKSVALMAPLPI
TM5 198 219 SILGLAIVLANFGLDSLLIVVS
TM6 241 265 NTCVSHICAVLIYYVPMIGVSVMHR
TM7 273 292 IVHTLMSSICLLVPPVLNPI

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage