Protein information for: OR52B6



MNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALEGNGILICVILS
QAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQM
FFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHS
FIIMFPSIFLLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAA
ALLSTGLDIMLITVSYIHILQAVFRLLSQDARSKALSTCGSHICVILLFY
VPALFSVFAYRFGGRSVPCYVHILLASLYVVIPPMLNPVIYGVRTKPILE
GAKQMFSNLAKGSK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 HIWLSIPFCIMYITALEGNGILICVIL
TM2 60 82 IFLSMLASADVLLSTTTMPKALA
TM3 97 116 LTQMFFIHFLFIHSAVLLAM
TM4 139 159 IGKIVTAALSHSFIIMFPSIF
TM5 196 217 YGLAAALLSTGLDIMLITVSYI
TM6 239 263 CGSHICVILLFYVPALFSVFAYRFG
TM7 272 291 HILLASLYVVIPPMLNPVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage