Protein information for: OR52E1P



MNTTLFHPYSFLLLGIPGLESMHLWVGFPFFAVFLTAVLGNITILFVIQT
DSSLHHPMFYFLAILSSIDPGLSTSTIPKMLGTFWFTLREISFEGCLTQM
FFIHLCTGMESAVLVAMAYDCYVAICDPLCYTLVLTNKVVSVMALAIFLR
PLVFVIPFVLFILRLPFCGHQIIPHTYGEHMGIARLSCASIRVNIIYGLC
AISILVFDIIAIVISYVQILCAVFLLSSHDARLKAFSTCGSHVCVMLTFY
MPAFFSFMTIGLVGIYLTLSDILLANFYVVIPPALNSVIYGVRTKQIRAQ
VLKMFFNK
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 HLWVGFPFFAVFLTAVLGNITILFVIQ
TM2 60 82 YFLAILSSIDPGLSTSTIPKMLG
TM3 97 117 LTQMFFIHLCTGMESAVLVAM
TM4 140 160 VSVMALAIFLRPLVFVIPFVL
TM5 197 217 YGLCAISILVFDIIAIVISYV
TM6 239 263 CGSHVCVMLTFYMPAFFSFMTIGLV
TM7 271 290 DILLANFYVVIPPALNSVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage