Protein information for: OR52E5



MLHTNNTQFHPSTFLVVGVPGLEDVHVWIGFPFFAVYLTALLGNIIILFV
IQTEQSLHQPMFYFLAMLAGTDLGLSTATIPKMLGIFWFNLGEIAFGACI
TQMYTIHICTGLESVVLTVTGIDRYIAICNPLRYSMILTNKVIAILGIVI
IVRTLVFVTPFTFLILRLPFCGVRIIPHTYCEHMGLAKLACASINVIYGL
IAFSVGYIDISVIGFSYVQILRAVFHLPAWDARPKALSTCGSHVCVMLAF
YLPALFSFMTHRFGHNIPHYIHILLANLYVVFPPALNSVIYGVKTKQIRE
QVLRILNPKSFWHFDPKRIFHNNSVRQ
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 HVWIGFPFFAVYLTALLGNIIILFVIQ
TM2 63 85 YFLAMLAGTDLGLSTATIPKMLG
TM3 100 120 ITQMYTIHICTGLESVVLTVT
TM4 143 163 IAILGIVIIVRTLVFVTPFTF
TM5 197 218 IYGLIAFSVGYIDISVIGFSYV
TM6 240 264 CGSHVCVMLAFYLPALFSFMTHRFG
TM7 272 291 HILLANLYVVFPPALNSVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage