Protein information for: OR52J2P



MAYHGNRGTSHPATFFLIGIPGLEDVHMXISLHFCSVYLLALLGNATILL
VIKAEQTLREPMFYFLAILSTIDLALSTTSVPRTLGIFWFDVHEINFGAC
VAQMFLIHAFTGMEAEVLVAMAFDHYVAICNPLHYTNILTCRVLVGITMC
ILIRPVLFTLPIIYLIYRLPFCQAHIIAHSYYEHMGIAKLSCGNIRVNAI
YGLFVVSLFLLNLVLIVISYVYILCAVFCLPSHDARLKALSTCGSHVGVI
CVFYIPSVFSFLTHXFGHNIPHYIHILVATLYLVIPPSLNPIICGVRTKW
KRERVLYVLTKK
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 HMXISLHFCSVYLLALLGNATILLVIK
TM2 64 86 YFLAILSTIDLALSTTSVPRTLG
TM3 101 121 VAQMFLIHAFTGMEAEVLVAM
TM4 144 164 LVGITMCILIRPVLFTLPIIY
TM5 201 221 YGLFVVSLFLLNLVLIVISYV
TM6 243 267 CGSHVGVICVFYIPSVFSFLTHXFG
TM7 275 294 HILVATLYLVIPPSLNPIIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage