Protein information for: OR52K3P



MSASSITSTHPTSFLLMGIPGLEHLHIWISIPFSAYTLALLGNCTLLLII
QADAALHEPIYLFLAMLAAIDLVLSSSALPKMLAIFWFRDREINFFACLV
QMFFLHSFSIMESAVLLAMAFDRYVAICKPLHYTTVLTGSLITKLAWLLW
PGLXHXXLHSTFLLRCFHYCRGPVIARCYCEHMAVVRLACGNTSFNNIYG
IAVAMFIGVLDLFFIILSYIFILQAVLQLSSQEARYKAFGTCVSHIGAIL
AFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQI
RDSLGSIPEKGCVNRE
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 51 HIWISIPFSAYTLALLGNCTLLLIIQ
TM2 62 84 LFLAMLAAIDLVLSSSALPKMLA
TM3 99 119 LVQMFFLHSFSIMESAVLLAM
TM4 142 162 ITKLAWLLWPGLXHXXLHSTF
TM5 199 220 YGIAVAMFIGVLDLFFIILSYI
TM6 242 266 CVSHIGAILAFYTPSVISSVMHRVA
TM7 274 293 HILLANFYLLFPPMVNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage