Protein information for: OR52M2P



MLTPNNACSVPTSFRLTGIPGLESLHIWLSIPFGSMYLVAVLGNITILAV
VRMEYSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFGAHNIGVNACL
AQMFFIHCFATVESGIFLAMAFDHYVAICDPLHHTLLLTHAVVGRLGLAA
LLRGVIYIGPLPLVICLRLPLYHTQIIAHSYCEHMAVVTLACGDTRVNNL
YGMGIGFLVLILDSLAITASYVMIFRAVMGLATSEARLKTLGTCGSHICA
ILVFYIPIAVSSLTHRFGHRVPPHIHIHIHIHIHIHILLANIYLLIPPIL
NPIVYAVRTKQIREALLHIKARTQTR
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 HIWLSIPFGSMYLVAVLGNITILAVVR
TM2 63 85 FFLCMLAVIDLVLSTSTMPKLLA
TM3 100 120 LAQMFFIHCFATVESGIFLAM
TM4 143 163 VGRLGLAALLRGVIYIGPLPL
TM5 201 222 YGMGIGFLVLILDSLAITASYV
TM6 244 268 CGSHICAILVFYIPIAVSSLTHRFG
TM7 286 305 HILLANIYLLIPPILNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage