Protein information for: OR52N5



MPLFNSLCWFPTIHVTPPSFILNGIPGLERVHVWISLPLCTMYIIFLVGN
LGLVYLIYYEESLHHPMYFFFGHASLIDLLTCTTTLPNALCIFWFSLKEI
NFNACLAQMFFVHGFTGVESGVLMLMALDRYVAICYPLRYATTLTNPIIA
KAELATFLRGVLLMIPFPFLVKRLPFCQSNIISHTYCDHMSVVKLSCASI
KVNVIYGLMVALLIGVFDICCISLSYTLILKAAISLSSSDARQKAFSTCT
AHISAIIITYVPAFFTFFAHRFGGHTIPPSLHIIVANLYLLLPPTLNPIV
YGVKTKQIRKSVIKFFQGDKGAG
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 32 58 HVWISLPLCTMYIIFLVGNLGLVYLIY
TM2 69 91 FFFGHASLIDLLTCTTTLPNALC
TM3 106 126 LAQMFFVHGFTGVESGVLMLM
TM4 149 169 IAKAELATFLRGVLLMIPFPF
TM5 206 227 YGLMVALLIGVFDICCISLSYT
TM6 249 273 CTAHISAIIITYVPAFFTFFAHRFG
TM7 282 301 HIIVANLYLLLPPTLNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage