Protein information for: OR52P1P



MESPHTLMLTLLVFFLLGIPGLEQFHLWLSLPVCGLGTATIVGNITILVV
VATEPVLHKPVYLFLCMLSTIDLAASVSTVPKLLAIFWCGAGHISASACL
AQMFFIHAFCMMESTVLLAMAFDRYVAICHPLRYATILTDTIIAHIGVAA
VVRGSLLMLPCPFFIGRLNFCQSHVILHTYCHMAVVKLACGDTRPNRVYG
LTAALLVTGVDLFCIGLSYALIAQAVLRLSSHEARSKALGTCGSHVCVIL
ISYTPALFSFFTHRFGHHVPVHIHILLANVYLLLPPALNPVVYGVKTKQI
RKRVVRVFQSGQEMGIKASE
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 HLWLSLPVCGLGTATIVGNITILVVVA
TM2 63 85 LFLCMLSTIDLAASVSTVPKLLA
TM3 100 120 LAQMFFIHAFCMMESTVLLAM
TM4 143 163 IAHIGVAAVVRGSLLMLPCPF
TM5 199 220 YGLTAALLVTGVDLFCIGLSYA
TM6 242 266 CGSHVCVILISYTPALFSFFTHRFG
TM7 274 293 HILLANVYLLLPPALNPVVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage