Protein information for: OR52Y1P



MFSXMPFCLSXILPXTYYEQVVMLNLVCADTHIXSVPVVSYGLFCGWIXY
ICHXNHRYQTLQAVLXLPAAESLPKVFSIYAFHICVTLFLHISVFYSFFS
CCFCYHTLTVIPISLLILYSLVPSMFNTITCGVKSKHIQENMVQRFCGKI
SC
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 2 28 FSXMPFCLSXILPXTYYEQVVMLNLVC
TM2 40 62 SYGLFCGWIXYICHXNHRYQTLQ
TM3 73 93 LPKVFSIYAFHICVTLFLHIS
TM4 107 124 LTVIPISLLILYSLVPSM
TM5 127 147 TITCGVKSKHIQENMVQRFCG
TM6 152 151
TM7 152 151

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage