Protein information for: OR52Z1P



MGIPGLEGLHTWISIPFSFMYIVAVAGNIFLIFLIMTERSLHEPMYLFLS
MLASADFLLATAAAPKVLAILWFHSMDISFGSCVSQMFFIHFIFVAESAI
LLAMAFDRYVAICYPLRYTILTSSAVRKIGIAAVVRSFFICCPFIFLVYR
LTYCGRNIIPHSYCEHIARLACGNINVNIIYGLTVALLSTGLDIVLIIIS
YTMILHSVFQISSWAARFKALSTCGSHICVIFMFYTPAFFSFLAHRFGGK
TIPHHIHILVGSLYVLVPPMLNPIIYGVKTKQIKDRVILLFSPISVC
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 10 36 HTWISIPFSFMYIVAVAGNIFLIFLIM
TM2 47 69 LFLSMLASADFLLATAAAPKVLA
TM3 84 104 VSQMFFIHFIFVAESAILLAM
TM4 126 146 VRKIGIAAVVRSFFICCPFIF
TM5 181 202 YGLTVALLSTGLDIVLIIISYT
TM6 224 248 CGSHICVIFMFYTPAFFSFLAHRFG
TM7 257 276 HILVGSLYVLVPPMLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage