Protein information for: OR55B1P



MGEDGNTSTFNISCTKFFLVGFPGLREWWPLLVLPLVFLFVTIISANALV
IHTVVARQNLHQPTCMLITVLLAVNIRAATAVMPKMLEGFVYYANPISLH
GRLAXVFFIYFTLLLDYNFLLAMALDCYVAICHPLCYSDLMTSQLLGLLA
ILALTQSLGVTVPLVVLTAKARFCRTAVIRHFTCECIALLSIACGDLTFN
NWLGLAMCLVTVISDMALLGTSYTHIIYAAFRISSWGAQAKALHTCGSHL
LVILSIYVSGLSTSITFXVAKTVSQNVQNLLSAIYLLLPGALNPVIYGVR
TREIQQHVEKMLCEKETAQKAGEKPKR
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 55 WPLLVLPLVFLFVTIISANALVIHTVV
TM2 66 88 MLITVLLAVNIRAATAVMPKMLE
TM3 103 123 LAXVFFIYFTLLLDYNFLLAM
TM4 146 166 LGLLAILALTQSLGVTVPLVV
TM5 203 224 LGLAMCLVTVISDMALLGTSYT
TM6 246 270 CGSHLLVILSIYVSGLSTSITFXVA
TM7 278 297 QNLLSAIYLLLPGALNPVIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage