Protein information for: OR56A1



MASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLI
TIQLEASLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPAC
FLQMFIMNSFLPMESCTFMVMAYDRYVAICHPLRYPSIITNQFVAKASVF
IVVRNALLTAPIPILTSLLHYCGENVIENCICANLSVSRLSCDNFTLNRI
YQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGAAVKALSTCGSHFIL
ILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYGVRTK
EIKQGIQKLLQRGR
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QHWLSLPLSLLFLLAMGANTTLLITIQ
TM2 64 86 YLLSLLSLLDIVLCLTVIPKVLA
TM3 101 121 FLQMFIMNSFLPMESCTFMVM
TM4 144 164 VAKASVFIVVRNALLTAPIPI
TM5 201 222 YQFVAGWTLLGSDLFLIFLSYT
TM6 244 268 CGSHFILILFFSTILLVVVLTNVAR
TM7 276 295 LILLNVLHHLIPPALNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage