Protein information for: OR56B3P



MDIGLSIANSSGFQLSEFILIGFPGIHEWQHWLSLPLALGANLLIIITIQ
HETMLHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPECFAQ
IYAIHSFMCMESGIFLCMAVDRYMAICYPLQYTSIVTEAFVIKATLSVVL
RNGLLTIPVPVLAAQRHYCSRNEIDQCLCSNLGVTSLACDDTTINRFYQL
ALVWVVVGSDMGLVFASYSLIIHSVLKLNSAKATSKALNTCSSHLILILF
FYTAIIVVSVTTWQEEGLPASRVLLNVLHIVIPSALNPIVYALRTXELRA
GFQKLLGLGEYVSRK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 PGIHEWQHWLSLPLALGANLLIIITIQ
TM2 61 83 HLLGILAVVDIGLATTIMPKILA
TM3 98 118 FAQIYAIHSFMCMESGIFLCM
TM4 141 161 VIKATLSVVLRNGLLTIPVPV
TM5 198 219 YQLALVWVVVGSDMGLVFASYS
TM6 241 265 CSSHLILILFFYTAIIVVSVTTWQE
TM7 272 291 RVLLNVLHIVIPSALNPIVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage