Protein information for: OR56B4



MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLL
IIITIQHETVLHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISL
PMCFAQIYAIHCFFCIESGIFLCMAVDRYIAICRPLQYPSIVTKAFVFKA
TGFIMLRNGLLTIPVPILAAQRHYCSRNEIEHCLCSNLGVISLACDDITV
NKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAMSKALSTCSSH
LILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRM
HKLRLGFQRLLGLGQDVSK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 30 56 QHWLSLPLTLLYLLALGANLLIIITIQ
TM2 67 89 HLLGILAVVDIGLATTIMPKILA
TM3 104 124 FAQIYAIHCFFCIESGIFLCM
TM4 147 167 VFKATGFIMLRNGLLTIPVPI
TM5 204 225 YQLMLAWVLVGSDMALVFSSYA
TM6 247 271 CSSHLILILFHTGIIVLSVTHLAEK
TM7 277 295 VFLNVLHNVIPPALNPLAC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage