Protein information for: OR5A1



MSITKAWNSSSVTMFILLGFTDHPELQALLFVTFLGIYLTTLAWNLALIF
LIRGDTHLHTPMYFFLSNLSFIDICYSSAVAPNMLTDFFWEQKTISFVGC
AAQFFFFVGMGLSECLLLTAMAYDRYAAISSPLLYPTIMTQGLCTRMVVG
AYVGGFLSSLIQASSIFRLHFCGPNIINHFFCDLPPVLALSCSDTFLSQV
VNFLVVVTVGGTSFLQLLISYGYIVSAVLKIPSAEGRWKACNTCASHLMV
VTLLFGTALFVYLRPSSSYLLGRDKVVSVFYSLVIPMLNPLIYSLRNKEI
KDALWKVLERKKVFS
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QALLFVTFLGIYLTTLAWNLALIFLIR
TM2 64 86 FFLSNLSFIDICYSSAVAPNMLT
TM3 101 121 AAQFFFFVGMGLSECLLLTAM
TM4 144 164 CTRMVVGAYVGGFLSSLIQAS
TM5 201 222 VNFLVVVTVGGTSFLQLLISYG
TM6 244 268 CASHLMVVTLLFGTALFVYLRPSSS
TM7 274 293 DKVVSVFYSLVIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage