Protein information for: OR5AC1P



MAEENKILVTHFVLTGLTDHPGLQAPLFLVFLVIYLITLVGNLGLMALIW
KDPHLHTPIYLFLGSLAFADACTSSSVTSKMLINFLSKNHMLSMAKCATQ
FYFFGSNATTECFLLVVMAYDRYVAICNPLLYPVVMSNSLCTQFIGISYF
IGFLHSAIHVGLLFRLTFCRSNIIHYFYCEILQLFKISCTNPTVNILLIF
IFSAFIQVFTFMTLIVSYSYILSAILKKKSEKGRSKAFSTCSAHLLSVSL
FYGTLFFMYVSSRSGSAADQAKMYSLFYTIIIPLLNPFIYSLRNKEVIDA
LRRIMKK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QAPLFLVFLVIYLITLVGNLGLMALIW
TM2 61 83 LFLGSLAFADACTSSSVTSKMLI
TM3 98 118 ATQFYFFGSNATTECFLLVVM
TM4 141 161 CTQFIGISYFIGFLHSAIHVG
TM5 198 219 LIFIFSAFIQVFTFMTLIVSYS
TM6 241 265 CSAHLLSVSLFYGTLFFMYVSSRSG
TM7 271 290 AKMYSLFYTIIIPLLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage