Protein information for: OR5AL1P



MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVV
YLASFMGNFGLIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVN
FLCEVKSITFYACAIQVCCFITFVVCELYLLSIMAYDRYVAICNPLLYVI
LIPRKCIKLIASTYVYGFTVGLVQTVATSYLSFCDSNVINHFYHDDVPLV
ALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFAILRIHSAEGRQ
KAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPTL
NPLIYSLRNQEVKNALKRIIEKLCLAVK
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 40 66 QVTLFGIFLVVYLASFMGNFGLIMLIQ
TM2 77 99 FFLSHLAFVDFSFTSSVAPNTLV
TM3 114 134 AIQVCCFITFVVCELYLLSIM
TM4 156 176 CIKLIASTYVYGFTVGLVQTV
TM5 213 234 MLLIIAGFNTLCSLVIVLISYG
TM6 256 280 SASHLTSITIFYGTIIFMYPQPKSS
TM7 286 305 DKVASVFNVVVIPTLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage