Protein information for: OR5AL2P



MAKGNHSSVTEFILLGLTDNQELQVILFGVFLLIYLVTVLGNLGLIVLIH
ISPQLHTPMYFFLSHLAFVDFYGTSAITPNTLVNSLHEIKSMSFYACATQ
VCCFITLSVWECIVALMAYDRYVAICNPLLYVVLMPRRLCIQMVTGLYIY
GFTMGLIQAVATFHMSFCDSNVVNQFYCDDVPLIALACSDTQVKELMLFI
IAAFNVFCSLIIVLISYVFIVCCYLRIHSAVGRQKAFSTCASHMFSISIY
YGTLSFMYLQPKSSHSLDKDKFASVFYAVVIPMLNPLIYSLRNQEVKNAM
KKIIEKM
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QVILFGVFLLIYLVTVLGNLGLIVLIH
TM2 61 83 FFLSHLAFVDFYGTSAITPNTLV
TM3 98 117 ATQVCCFITLSVWECIVALM
TM4 140 160 CIQMVTGLYIYGFTMGLIQAV
TM5 197 218 MLFIIAAFNVFCSLIIVLISYV
TM6 240 264 CASHMFSISIYYGTLSFMYLQPKSS
TM7 270 289 DKFASVFYAVVIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage