Protein information for: OR5AM1P



VSMSFLIRSDSTLHTPMCLFLSHLSFVDLYYATNATPPMLVNFIFSKRKT
VSFIGCFIQFHLFIALVITDYHMLTVMVYDHYMAICKLLYGSKMSRCVCL
CLTAAPYIYGSANGLVQVILMLCLFFCEPNEINHFFFFGENALYAHLIPL
XTYXRREYHPESIYNGRKEPVDPSFHILIMAYKVMIIFSVXSISQGXLXC
KIGDQPLLLCRPPLLVLACLDTYVKETAMFMVAGSNLICPLTIIFISYTF
IFTDILHICTAEGRYNAFSTCGSLVTAVTVFQGTLFHMCLRPPSEASVEQ
GKIVAAFYIFVSPTLNPLIYRLRNKNVKRTIREVIQKKLFAK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 52 78 SFIGCFIQFHLFIALVITDYHMLTVMV
TM2 90 112 YGSKMSRCVCLCLTAAPYIYGSA
TM3 128 148 EPNEINHFFFFGENALYAHLI
TM4 174 194 SFHILIMAYKVMIIFSVXSIS
TM5 228 249 AMFMVAGSNLICPLTIIFISYT
TM6 271 295 CGSLVTAVTVFQGTLFHMCLRPPSE
TM7 301 320 GKIVAAFYIFVSPTLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage