Protein information for: OR5AP2



MMRLMKEVRGRNQTEVTEFLLLGLSDNPDLQGVLFALFLLIYMANMVGNL
GMIVLIKIDLCLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAENKAIS
FHGCAAQFYFFGSFLGTECFLLAMMAYDRYAAIWNPLLYPVLVSGRICFL
LIATSFLAGCGNAAIHTGMTFRLSFCGSNRINHFYCDTPPLLKLSCSDTH
FNGIVIMAFSSFIVISCVMIVLISYLCIFIAVLKMPSLEGRHKAFSTCAS
YLMAVTIFFGTILFMYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLK
NKDVKKALKKILWKHIL
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 31 57 QGVLFALFLLIYMANMVGNLGMIVLIK
TM2 68 90 FFLSSLSFVDASYSSSVTPKMLV
TM3 105 125 AAQFYFFGSFLGTECFLLAMM
TM4 148 168 CFLLIATSFLAGCGNAAIHTG
TM5 205 226 VIMAFSSFIVISCVMIVLISYL
TM6 248 272 CASYLMAVTIFFGTILFMYLRPTSS
TM7 278 297 DKVVSVFYTVIIPVLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage