Protein information for: OR5AW1P



MCLTIVMHCEFFLMDLTDDPQLHPTFSALFLPIYVVMVIGNLGLLAFIVV
SPQFLTPMYFFLSNWSSVDFCYSSVTVPKISMGFFSDCQVFSFSGCMAQL
SCFXNFADTEFFLLASMVYYRXEAVCNPLLYHITMSPKLCLQLVATSYEH
GAPXXHNLSSDLLXVCAIIHXFCYLPPPPRLXKLSCSDMQGLQLLTFASS
SFNVSVSRTIFLVSIXLXECPRFEANTCASHLTAVSLCYGTTVFLHLHLS
LKCSPDRDMLSLFYTVAILMLNPMVQSLRNKDVKKTFGTSSXRFTIPLLP
HAQVPTLS
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 HPTFSALFLPIYVVMVIGNLGLLAFIV
TM2 60 82 FFLSNWSSVDFCYSSVTVPKISM
TM3 97 117 MAQLSCFXNFADTEFFLLASM
TM4 140 160 CLQLVATSYEHGAPXXHNLSS
TM5 188 209 DMQGLQLLTFASSSFNVSVSRT
TM6 228 252 CASHLTAVSLCYGTTVFLHLHLSLK
TM7 257 275 DMLSLFYTVAILMLNPMVQ

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage