Protein information for: OR5B10P



YLTVTPRVTASRLGYLEGRRLSSSYNACAAQMFFFVALATVENILLTSMA
YDHYIAVCKPLHYTTTTIASVCAHLVIGSYVCGFLNASLRIGDIFSLSFC
KSNLVHHLFCDVPPVMAVSCSGKHISKKILVFMSSFNVFLALLVILTSYL
FIFITILKMHSAQGHLKALSTCASHLIAVSIFYGTTIFMHLQPSSSHSMD
TDEMASLFYAVFI
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 0 15 YLTVTPRVTASRLGYL
TM2 23 22
TM3 29 49 AAQMFFFVALATVENILLTSM
TM4 72 92 CAHLVIGSYVCGFLNASLRIG
TM5 129 150 ILVFMSSFNVFLALLVILTSYL
TM6 172 196 CASHLIAVSIFYGTTIFMHLQPSSS
TM7 201 208 DEMASLFY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage