Protein information for: OR5B15P



SQTTSIDDNTEVNEFIXLGLTKAPELQVHLFVLFNFIYLFTLSGNLGMML
LILLDSRLHTSMYFFLSNLSLVDFCYSETVTPKMMAGLLIAHKVISYNVC
AAQMFFFAVFATVESYFLTSVAYDCYRVMCKPLHYTTTMTTNVCASLAIH
AFLGLLTAAVDIGDICMSNEIHHFFCDILAVMTLTCSNKHINELILFLLQ
AIFFTLLVILISCLFVFVFVTILKMLSSKYTSKVLSTYGSHLTAVPLFYE
TVLITYVQPSSSHFMNTEKIVSVFHIMVIPMLIPVVYSLRNNEVKSAFKT
VCXGNK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QVHLFVLFNFIYLFTLSGNLGMMLLIL
TM2 64 86 FFLSNLSLVDFCYSETVTPKMMA
TM3 101 121 AAQMFFFAVFATVESYFLTSV
TM4 144 164 CASLAIHAFLGLLTAAVDIGD
TM5 195 216 ILFLLQAIFFTLLVILISCLFV
TM6 238 262 YGSHLTAVPLFYETVLITYVQPSSS
TM7 268 287 EKIVSVFHIMVIPMLIPVVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage