Protein information for: OR5B19P



MXNSREASQFIFLGLSNVPELQVPFFIMFVLIYLINVVGNLGMIILILWY
SQLHNPMYFFFSNLSLVDFFYSSVVTPKVMTGLLREDKIISYTVWATQTF
FSDSFASVVNLLLALMASGHYAAVCKPLHYTTTMMTSVCTCLAIGXYVGG
FLNASIHTGETFSLFCMSSEVHHFFCEVPAVMALSCSDRHVNVVVLVYVT
SFNILFALLVILISYLLMFITILKMHSTAGYQKALAICASHLTAVAIFYG
TIIFMHIQPSSSHSIDTDKIAAVFYTIVFPMVNHVVXRLKNKVKSTFKKI
VEKVKLSLGL
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QVPFFIMFVLIYLINVVGNLGMIILIL
TM2 59 81 FFFSNLSLVDFFYSSVVTPKVMT
TM3 96 116 ATQTFFSDSFASVVNLLLALM
TM4 139 159 CTCLAIGXYVGGFLNASIHTG
TM5 195 216 VLVYVTSFNILFALLVILISYL
TM6 238 262 CASHLTAVAIFYGTIIFMHIQPSSS
TM7 268 287 DKIAAVFYTIVFPMVNHVVX

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage