Protein information for: OR5BA1P



LPTVTSADDTWRLALASGNHTPVTKFILQGFSNYPDLQELLFGAILLIYA
ITVVGNLGMMALIFTDSHLQSPMYFFLNVLSFLDICYSSVVTPKLLVNFL
VSDKSISFEGCVVQLAFFVVHVTAESFLLASMAYDRFLAICQPLHYGSIM
TRGTCLQLVAVSYAFGGANSAIQTGNVFALPFCGPNXLTHYYCDIPPLLH
LACANTATARVVLYVFSALVTLLPAAVILTSYCLVLVAIGRMRSVAGREK
DLSTCASHFLAIAIFYGTVVFTYVQPHGSTNNTNGQVVSVFYTIIIPMLN
PFIYSLRNKEVKGALQRKLQVNIFPG
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 38 64 QELLFGAILLIYAITVVGNLGMMALIF
TM2 75 97 FFLNVLSFLDICYSSVVTPKLLV
TM3 112 132 VVQLAFFVVHVTAESFLLASM
TM4 155 175 CLQLVAVSYAFGGANSAIQTG
TM5 212 233 VLYVFSALVTLLPAAVILTSYC
TM6 255 279 CASHFLAIAIFYGTVVFTYVQPHGS
TM7 285 304 GQVVSVFYTIIIPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage