Protein information for: OR5BD1P



MPAWAMREKPCKKKKKHSSLLFAVFLLTYSVTLVGNLGMTDLICQSRTSH
TPMCFLLSVFSFLDICSSSIVHPRLLIHFLTTRPSISFAGGIIQMALMTF
YGTGECLLLAIVAYDXVVAICHPFPXHIIMSKGLCAQLVVVTSAVGVLIS
AHRQDAFISPYRGLNIIDHYYCSVTFPLQLACSDATVANMILFVSSALIT
IPTISVILVSYTYILVNLVRMRSLDAQCKAFSTRASHLTAHCLFYGFVFL
VYIPPNPEMASAYNKILFTVVIPMLNLLVXGLRNKDVKGWVLWLLPVTPV
L
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 18 44 SSLLFAVFLLTYSVTLVGNLGMTDLIC
TM2 55 77 FLLSVFSFLDICSSSIVHPRLLI
TM3 92 112 IIQMALMTFYGTGECLLLAIV
TM4 135 155 CAQLVVVTSAVGVLISAHRQD
TM5 191 212 ILFVSSALITIPTISVILVSYT
TM6 234 258 RASHLTAHCLFYGFVFLVYIPPNPE
TM7 264 279 KILFTVVIPMLNLLVX

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage