Protein information for: OR5BJ1P



MKNLIIITEFVLMESSRNPQIQTMTCMLLVIYLLSLMENLMMILVIRTNS
HLKTTMYFFLGHLSLLDLCLPSIPVPKMLQNLLTQRXTISMWYCIVQSFF
LIFSGSTEACLLLAMACDHSTSNCHPRLNDVVMNQPVCVRMVIAAWAVGF
LNSLTKNLFIYNLHFCGPSVIPHFCCELPSLFPLSCIDPAASEVLPAGSC
TLLGFVTCRCVLFSYSNTISAILAICFSEGQGKAFSTCSSHLTVVLLYYG
KVLLRYTTPLLGSILEQVVCIQYSVITSSLKPLICSLKNQEVKTALCKML
KQ
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 21 47 IQTMTCMLLVIYLLSLMENLMMILVIR
TM2 58 80 FFLGHLSLLDLCLPSIPVPKMLQ
TM3 95 115 IVQSFFLIFSGSTEACLLLAM
TM4 138 158 CVRMVIAAWAVGFLNSLTKNL
TM5 195 216 LPAGSCTLLGFVTCRCVLFSYS
TM6 238 262 CSSHLTVVLLYYGKVLLRYTTPLLG
TM7 267 284 VVCIQYSVITSSLKPLIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage