Protein information for: OR5BR1P



MTVERSSMTITKFILLGFSEYSKTTIFLFSVFLGIYLLTMSXNVSLIALI
RTDSHLHAPVYFFLSNPSFLDICCVSTIAPKMPSDFFKKHKFISFMGCTM
QYFSSLNVTECCLLTAMAYDXYAAICDPLLYTAIMSPALCMPMVAGSCTT
GYFVSFIQLCALLLLHFCESNSSHFFCDLPQLLILSCSTVFFSQVMTTML
TVTFILTSILVIMITYGYIIANIISFMGCTMXYFFSSLGLTECCLLEAMA
YNXYAAICDPLLYMAIHVPRPLCAHNGWNLYNYYLWLIYPTSALLQLHFC
GPNSNHFFCDLPQLLILSCYDTFFCQVMTSMLTVVFGLTSVLVIMIFYGY
VIATILKIISVEGRSKVFNTGGSHLIAVTLFYCSRIFVYMCSHSDASLSR
NKVDSIVYTVVIPRLNPLIYSLSDKXIKDALKRWTKRIFSWP
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 TIFLFSVFLGIYLLTMSXNVSLIALIR
TM2 62 84 FFLSNPSFLDICCVSTIAPKMPS
TM3 99 117 TMQYFSSLNVTECCLLTAM
TM4 140 160 CMPMVAGSCTTGYFVSFIQLC
TM5 196 217 MTTMLTVTFILTSILVIMITYG
TM6 371 395 GGSHLIAVTLFYCSRIFVYMCSHSD
TM7 401 420 NKVDSIVYTVVIPRLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage