Protein information for: OR5BT1P



MNXFVFLGLSRPHPQIQTPLFVLFLVIYLLTLIGNLMMLLVINADSCLRT
PMXFFLGHFFFLDICYSSVISPKMLQNFLFHKNLSWCGVISPRVSFSFFL
GAPMCCLLSAITYACYAAICHPLLSTMVMNRPLCTATVNATNKMGFLNSQ
VNNLCIQHLQFCGPNIILHFSYETVFTLPSVLHXSHANTILLSGSIAFLR
LVTLPLNLFAYSKIMFAILGISSSGGQGKTCYSHLTMVLLFYGTALFKHI
SPPLGSVLEQAVSIQYAQFHTCILYRGVITSLLNLLIYSFKKQEVKAVHF
EHREKWHMCLQMVKEXXKQ
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 17 43 QTPLFVLFLVIYLLTLIGNLMMLLVIN
TM2 54 76 FFLGHFFFLDICYSSVISPKMLQ
TM3 91 111 SPRVSFSFFLGAPMCCLLSAI
TM4 134 154 CTATVNATNKMGFLNSQVNNL
TM5 191 212 LLSGSIAFLRLVTLPLNLFAYS
TM6 231 255 CYSHLTMVLLFYGTALFKHISPPLG
TM7 269 288 FHTCILYRGVITSLLNLLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage