Protein information for: OR5D2P



SLFCPRDQENQTSEVTFILLGFSEYPDLQTPLFLVFLTIYTVTVLGNLGM
IIVIRISPKLHTPMCFFLSHLSFVDFCYSTTITPKLLENLVVEDRTISFT
GCTMQLFFVCIFVVTETFMLAVMAYDRYVAVCNPLLYTVAMYQRLCSLLV
ATSYCWGIVCSLTLTXFLLELSFRGNNIINNFVCEHAAIVAVSCSDPCVS
QEITLVSATFNEISSLLSYAFIFITVMKTPSTGGRKKAFSTSASHLTAIT
IFHGTILFLYCVPNSKSSWLMVKVASVFYTVVIPMLNPLIYSLRNKDVKE
TVRRLLITKLLCL
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 55 QTPLFLVFLTIYTVTVLGNLGMIIVIR
TM2 66 88 FFLSHLSFVDFCYSTTITPKLLE
TM3 103 123 TMQLFFVCIFVVTETFMLAVM
TM4 146 166 CSLLVATSYCWGIVCSLTLTX
TM5 203 224 ITLVSATFNEISSLLSYAFIFI
TM6 242 266 SASHLTAITIFHGTILFLYCVPNSK
TM7 272 291 VKVASVFYTVVIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage