Protein information for: OR5G4P



MISSLFFSLXRLKQPMADGNYKRITEFIFVGLRYHLQLQVFLFLPFLPFY
LITMTENLGMMVRIWLDSCFHTPMYFVLSYLSFVDICFSSVVGHKLLTDL
FAVRKAISFLGCPLQQWFFGFFIVIEYLLLASMAYDNYVAICNPLLYSVA
MXXRLCIQLVVVRYAADFFNTITHTTAAFHFPFFHSNIINHFFCDMSLLL
SLVCADARINKLLVFIVAGAVLVVSSLTIIISYFYILTDILRICSANGKN
KTFSTCSSHLTAVSIFYGSLFFSYVRPGATFYPELNKIVLVFCIIPMLKP
LIYSLINKEVSXPLDHQGSGERIPYLI
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 39 65 QVFLFLPFLPFYLITMTENLGMMVRIW
TM2 76 98 FVLSYLSFVDICFSSVVGHKLLT
TM3 113 133 PLQQWFFGFFIVIEYLLLASM
TM4 156 176 CIQLVVVRYAADFFNTITHTT
TM5 213 234 LVFIVAGAVLVVSSLTIIISYF
TM6 256 280 CSSHLTAVSIFYGSLFFSYVRPGAT
TM7 284 303 ELNKIVLVFCIIPMLKPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage