Protein information for: OR5H3P



MEEENATLLTEFVLTGLLYQPQWKIPLFLTFLVIYLITIMGNLGLIAVIW
KDPHLQIPMYLLLGNLAFVDAWISSTVTPKMLNNFLAKSKMVSLPESKIQ
FFSFAISVTTECFLLATMAYDRYVAICKPLLYPAIMTNGLCIRLVGGLLH
ALIHEGFLFRLTFCNSNVVHHIYCDIIPLSKISCTDSSINFLMVFIFSGS
IQVFTIGTGLISYTFVLFTILKKKSVKGIRKAFSTCGAHLLSVSLYHGPL
DFMYMGSASPQADDEDMMESLFYTVIVPLLNPMTYSLRNKQVIASFTKMF
KRNNI
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 KIPLFLTFLVIYLITIMGNLGLIAVIW
TM2 61 83 LLLGNLAFVDAWISSTVTPKMLN
TM3 98 118 KIQFFSFAISVTTECFLLATM
TM4 141 161 CIRLVGGLLHALIHEGFLFRL
TM5 193 214 MVFIFSGSIQVFTIGTGLISYT
TM6 236 260 CGAHLLSVSLYHGPLDFMYMGSASP
TM7 266 285 DMMESLFYTVIVPLLNPMTY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage