Protein information for: OR5H5P



MEEKNATLLTEFVLTLFLYQPHWKIPLFLAFLVIYLITIFGNLGLIAVVW
KDPHLHIPIYLFLENLAFVDDLLSSTVTLKMLINFFTKSKLISLXMLDTF
FFLCNWCNTECFILATMAYDRYVAICKPLLYPVIMTNGLCIWLLILSFLG
GLLHALIHEGFFRLTFCNSNTIHHFXCDIIPLLKIFCTDSSINFPMVFIF
SCSIQVFTIGTVLVSYTFVLSTILKKKSVKGIRKDFSTCGAHILPVSLYY
GPLAFMYVGSASQRADDQDMMESLFYTVIVPLLNPMIYSLRNKQVIDSFT
KMFKGNNV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 KIPLFLAFLVIYLITIFGNLGLIAVVW
TM2 61 83 LFLENLAFVDDLLSSTVTLKMLI
TM3 97 117 LDTFFFLCNWCNTECFILATM
TM4 140 160 CIWLLILSFLGGLLHALIHEG
TM5 196 217 MVFIFSCSIQVFTIGTVLVSYT
TM6 239 263 CGAHILPVSLYYGPLAFMYVGSASQ
TM7 269 288 DMMESLFYTVIVPLLNPMIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage